PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G259800.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 318aa    MW: 36201.6 Da    PI: 8.3251
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G259800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-1671116147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg W + Ed +l+++v q+G+ +W++Ia+++  gR++k+c++rw++ 
  Aqcoe3G259800.2.p  71 RGHWKPGEDARLIELVSQFGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 116
                        899*****************************.***********996 PP

2Myb_DNA-binding50.74.2e-16123167147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r+++++eE+e+l+ a + +G++ W+ Iar ++ gRt++ +k++w+  
  Aqcoe3G259800.2.p 123 RKAFSQEEEEKLLAARRFYGNK-WAVIARLFP-GRTDNAVKNHWHVT 167
                        789*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.37466121IPR017930Myb domain
SMARTSM007174.8E-1370119IPR001005SANT/Myb domain
SuperFamilySSF466893.11E-2770164IPR009057Homeodomain-like
PfamPF002491.0E-1571116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2572124IPR009057Homeodomain-like
CDDcd001672.08E-1174115No hitNo description
SMARTSM007172.3E-14122170IPR001005SANT/Myb domain
PROSITE profilePS5129417.599122172IPR017930Myb domain
PfamPF002493.8E-13123165IPR001005SANT/Myb domain
CDDcd001671.29E-10125165No hitNo description
Gene3DG3DSA:1.10.10.608.8E-19125171IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEMQFLSSSP LELQQKGWNF QTLNSKGNDF YESELIFMNQ GGDMEEKIES FAAKKDNEVI  60
AGKFHVKSCS RGHWKPGEDA RLIELVSQFG PQNWNLIAEK LEGRSGKSCR LRWFNQLDPR  120
INRKAFSQEE EEKLLAARRF YGNKWAVIAR LFPGRTDNAV KNHWHVTMAR RHKEESNVYK  180
RRKVSACSQP VYNTMEMKMT NSTNNAQREF IITSSKDESV STCTDLSMNS SSTRSNPFLF  240
TNNSPHKHQQ LYQVQMGNGM YQFESTMMAM GINQSGSSFS NSEVSTDSMA INVKDSIENV  300
SESSNVHFID FLGVGTT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-32661712107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245158.11e-104PREDICTED: myb-related protein 330-like
RefseqXP_010245159.11e-104PREDICTED: myb-related protein 330-like
RefseqXP_010245160.11e-104PREDICTED: myb-related protein 330-like
TrEMBLB9IPV55e-94B9IPV5_POPTR; Uncharacterized protein
STRINGPOPTR_0019s05740.11e-93(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-69myb domain protein 105